ARHGAP15 antibody (Middle Region)
-
- Target See all ARHGAP15 Antibodies
- ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARHGAP15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARHGAP15 antibody was raised against the middle region of ARHGAP15
- Purification
- Affinity purified
- Immunogen
- ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
- Top Product
- Discover our top product ARHGAP15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))
- Alternative Name
- ARHGAP15 (ARHGAP15 Products)
- Synonyms
- pp905 antibody, sh3d20 antibody, sh3p20 antibody, camgap1 antibody, BM046 antibody, 5830480G12Rik antibody, Rho GTPase activating protein 15 antibody, Rho GTPase activating protein 27 antibody, ARHGAP15 antibody, arhgap27 antibody, Arhgap15 antibody
- Background
- RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.
- Molecular Weight
- 54 kDa (MW of target protein)
-