ARHGAP15 antibody (Middle Region)

Catalog No. ABIN632948

Product Details anti-ARHGAP15 Antibody

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Purification: Affinity purified

Immunogen: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP15

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Alternative Name: ARHGAP15 (ARHGAP15 Products)

Synonyms: pp905 antibody, sh3d20 antibody, sh3p20 antibody, camgap1 antibody, BM046 antibody, 5830480G12Rik antibody, Rho GTPase activating protein 15 antibody, Rho GTPase activating protein 27 antibody, ARHGAP15 antibody, arhgap27 antibody, Arhgap15 antibody

Background: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Molecular Weight: 54 kDa (MW of target protein)