DNAAF2 antibody (N-Term)

Catalog No. ABIN632937

Product Details anti-DNAAF2 Antibody

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAAF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF104 antibody was raised against the N terminal Of C14 rf104

Purification: Affinity purified

Immunogen: C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAAF2

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Alternative Name: C14ORF104 (C14orf104 Products)

Synonyms: 1110034A24Rik antibody, 2810020C19Rik antibody, AV032410 antibody, Ktu antibody, TU54 antibody, mknt antibody, C14orf104 antibody, CILD10 antibody, KTU antibody, PF13 antibody, C10H14orf104 antibody, RGD1310311 antibody, c14orf104 antibody, cild10 antibody, kintoun antibody, ktu antibody, zgc:110294 antibody, dynein axonemal assembly factor 2 antibody, dynein, axonemal assembly factor 2 antibody, dynein, axonemal, assembly factor 2 antibody, dynein, axonemal, assembly factor 2 L homeolog antibody, DNAAF2 antibody, Dnaaf2 antibody, dnaaf2.L antibody, dnaaf2 antibody

Background: This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 91 kDa (MW of target protein)