FAM90A1 antibody (N-Term)
-
- Target See all FAM90A1 Antibodies
- FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM90A1 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- FAM90 A1 antibody was raised against the N terminal of FAM90 1
- Purification
- Affinity purified
- Immunogen
- FAM90 A1 antibody was raised using the N terminal of FAM90 1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP
- Top Product
- Discover our top product FAM90A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM90A1 Blocking Peptide, catalog no. 33R-7006, is also available for use as a blocking control in assays to test for specificity of this FAM90A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))
- Alternative Name
- FAM90A1 (FAM90A1 Products)
- Background
- FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements.
- Molecular Weight
- 50 kDa (MW of target protein)
-