FAM90A1 antibody (N-Term)

Catalog No. ABIN632936

Product Details anti-FAM90A1 Antibody

Target: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM90A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM90 A1 antibody was raised against the N terminal of FAM90 1

Purification: Affinity purified

Immunogen: FAM90 A1 antibody was raised using the N terminal of FAM90 1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM90A1 Blocking Peptide, catalog no. 33R-7006, is also available for use as a blocking control in assays to test for specificity of this FAM90A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM90A1

Target: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Alternative Name: FAM90A1 (FAM90A1 Products)

Synonyms: family with sequence similarity 90 member A1 antibody, FAM90A1 antibody

Background: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements.

Molecular Weight: 50 kDa (MW of target protein)