MAP7D1 antibody (N-Term)

Catalog No. ABIN632935

Product Details anti-MAP7D1 Antibody

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP7D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP7 D1 antibody was raised against the N terminal of MAP7 1

Purification: Affinity purified

Immunogen: MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP7D1 Blocking Peptide, catalog no. 33R-8156, is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP7D1

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Alternative Name: MAP7D1 (MAP7D1 Products)

Synonyms: PARCC1 antibody, RPRC1 antibody, Mtap7d1 antibody, AV028413 antibody, BC019977 antibody, Parcc1 antibody, Rprc1 antibody, mKIAA1187 antibody, zgc:172238 antibody, MAP7 domain containing 1 antibody, MAP7 domain containing 1b antibody, MAP7D1 antibody, Map7d1 antibody, map7d1b antibody

Background: The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection