SLFN12 antibody (N-Term)

Catalog No. ABIN632933

Product Details anti-SLFN12 Antibody

Target: SLFN12 (Schlafen Family Member 12 (SLFN12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLFN12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLFN12 antibody was raised against the N terminal of SLFN12

Purification: Affinity purified

Immunogen: SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLFN12 Blocking Peptide, catalog no. 33R-4534, is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLFN12

Target: SLFN12 (Schlafen Family Member 12 (SLFN12))

Alternative Name: SLFN12 (SLFN12 Products)

Synonyms: SLFN3 antibody, SLFN12L antibody, schlafen family member 12 antibody, SLFN12 antibody

Background: The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 67 kDa (MW of target protein)