SLFN12 antibody (N-Term)
-
- Target See all SLFN12 products
- SLFN12 (Schlafen Family Member 12 (SLFN12))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLFN12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLFN12 antibody was raised against the N terminal of SLFN12
- Purification
- Affinity purified
- Immunogen
- SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLFN12 Blocking Peptide, catalog no. 33R-4534, is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFN12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLFN12 (Schlafen Family Member 12 (SLFN12))
- Alternative Name
- SLFN12 (SLFN12 Products)
- Background
- The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 67 kDa (MW of target protein)
-