RMND1 antibody

Catalog No. ABIN632930

Product Details anti-RMND1 Antibody

Target: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RMND1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RMND1 Blocking Peptide, catalog no. 33R-4909, is also available for use as a blocking control in assays to test for specificity of this RMND1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RMND1

Target: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Alternative Name: RMND1 (RMND1 Products)

Synonyms: zgc:113022 antibody, DKFZp469I1433 antibody, C6orf96 antibody, COXPD11 antibody, RMD1 antibody, bA351K16 antibody, bA351K16.3 antibody, 0610042C05Rik antibody, AA408137 antibody, AI462664 antibody, AW536662 antibody, Iag-1 antibody, RGD1309546 antibody, required for meiotic nuclear division 1 homolog antibody, RMND1 antibody, rmnd1 antibody, Rmnd1 antibody

Background: The function of RMND1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)