CHCHD3 antibody (N-Term)

Catalog No. ABIN632928

Product Details anti-CHCHD3 Antibody

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHCHD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHCHD3 antibody was raised against the N terminal of CHCHD3

Purification: Affinity purified

Immunogen: CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHCHD3 Blocking Peptide, catalog no. 33R-8063, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHCHD3

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Alternative Name: CHCHD3 (CHCHD3 Products)

Synonyms: MINOS3 antibody, PPP1R22 antibody, 0610041L09Rik antibody, 1700039J09Rik antibody, AW558177 antibody, plxna4 antibody, FLJ20420 antibody, wu:fe23h05 antibody, zgc:111837 antibody, si:rp71-18a24.1 antibody, MGC80265 antibody, MGC88973 antibody, coiled-coil-helix-coiled-coil-helix domain containing 3 antibody, coiled-coil-helix-coiled-coil-helix domain containing 3a antibody, coiled-coil-helix-coiled-coil-helix domain containing 3 L homeolog antibody, CHCHD3 antibody, Chchd3 antibody, chchd3a antibody, chchd3.L antibody, chchd3 antibody, LOC100229580 antibody

Background: ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.

Molecular Weight: 26 kDa (MW of target protein)