C20orf111 antibody (N-Term)
C20orf111
Reactivity: Mouse, Rat, Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all C20orf111 products
- C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))
- Binding Specificity
- N-Term
-
Reactivity
- Mouse, Rat, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C20orf111 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C20 ORF111 antibody was raised against the N terminal Of C20 rf111
- Purification
- Affinity purified
- Immunogen
- C20 ORF111 antibody was raised using the N terminal Of C20 rf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG
-
anti-Chromosome 20 Open Reading Frame 111 (C20orf111) (N-Term) antibody
C20orf111 Reactivity: Mouse, Rat, Human, Rabbit, Cow, Zebrafish (Danio rerio), Dog, Guinea Pig, Horse WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C20ORF111 Blocking Peptide, catalog no. 33R-7916, is also available for use as a blocking control in assays to test for specificity of this C20ORF111 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF111 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))
- Alternative Name
- C20ORF111 (C20orf111 Products)
- Synonyms
- MGC76290 antibody, DKFZp468B2423 antibody, C20orf111 antibody, MGC134505 antibody, c20orf111 antibody, HSPC207 antibody, Osr1 antibody, Perit1 antibody, dJ1183I21.1 antibody, oxidative stress responsive serine-rich 1 antibody, oxidative stress responsive serine rich 1 antibody, oxidative stress responsive serine-rich 1 L homeolog antibody, oser1 antibody, OSER1 antibody, oser1.L antibody
- Background
- The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 32 kDa (MW of target protein)
-
You are here:
