RPS27L antibody (N-Term)
-
- Target See all RPS27L Antibodies
- RPS27L (Ribosomal Protein S27L (RPS27L))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPS27L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPS27 L antibody was raised against the N terminal of RPS27
- Purification
- Affinity purified
- Immunogen
- RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
- Top Product
- Discover our top product RPS27L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPS27L Blocking Peptide, catalog no. 33R-6290, is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS27L (Ribosomal Protein S27L (RPS27L))
- Alternative Name
- RPS27L (RPS27L Products)
- Synonyms
- 1810034D23Rik antibody, ribosomal protein S27 like antibody, ribosomal protein S27-like antibody, RPS27L antibody, Rps27l antibody
- Background
- This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.
- Molecular Weight
- 9 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-