MFAP1 antibody (Middle Region)

Catalog No. ABIN632905

Product Details anti-MFAP1 Antibody

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MFAP1 antibody was raised against the middle region of MFAP1

Purification: Affinity purified

Immunogen: MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP1 Blocking Peptide, catalog no. 33R-9156, is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP1

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Alternative Name: MFAP1 (MFAP1 Products)

Synonyms: AMF antibody, zgc:56551 antibody, mfap1 antibody, microfibril associated protein 1 antibody, microfibrillar associated protein 1 antibody, microfibril associated protein 1 L homeolog antibody, MFAP1 antibody, Mfap1 antibody, mfap1 antibody, mfap1.L antibody

Background: MFAP1 is a component of the elastin-associated microfibrils.

Molecular Weight: 52 kDa (MW of target protein)