PSMA5 antibody

Catalog No. ABIN632898

Product Details anti-PSMA5 Antibody

Target: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMA5 Blocking Peptide, catalog no. 33R-5998, is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA5

Target: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Alternative Name: PSMA5 (PSMA5 Products)

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA