PREP antibody (N-Term)
-
- Target See all PREP Antibodies
- PREP (Prolyl Endopeptidase (PREP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PREP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PREP antibody was raised against the N terminal of PREP
- Purification
- Affinity purified
- Immunogen
- PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
- Top Product
- Discover our top product PREP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PREP Blocking Peptide, catalog no. 33R-9102, is also available for use as a blocking control in assays to test for specificity of this PREP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PREP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PREP (Prolyl Endopeptidase (PREP))
- Alternative Name
- PREP (PREP Products)
- Synonyms
- PE antibody, PEP antibody, AI047692 antibody, AI450383 antibody, D10Wsu136e antibody, Pop antibody, rPop antibody, im:7140031 antibody, zgc:110670 antibody, prolyl endopeptidase antibody, Prolyl endopeptidase antibody, RB12337 antibody, AM1_4884 antibody, ppce antibody, PREP antibody, Prep antibody, prep antibody
- Background
- PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.
- Molecular Weight
- 81 kDa (MW of target protein)
-