TBC1D14 antibody (N-Term)

Catalog No. ABIN632891

Product Details anti-TBC1D14 Antibody

Target: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D14 antibody was raised against the N terminal of TBC1 14

Purification: Affinity purified

Immunogen: TBC1 D14 antibody was raised using the N terminal of TBC1 14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D14 Blocking Peptide, catalog no. 33R-6536, is also available for use as a blocking control in assays to test for specificity of this TBC1D14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D14

Target: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Alternative Name: TBC1D14 (TBC1D14 Products)

Synonyms: fi35h01 antibody, si:dkey-120m5.1 antibody, wu:fi35h01 antibody, wu:fi42a03 antibody, DKFZp469A1818 antibody, 2810413P16Rik antibody, AU043625 antibody, C86258 antibody, D5Ertd110e antibody, mKIAA1322 antibody, SRF-2 antibody, TBC1 domain family member 14 antibody, TBC1 domain family, member 14 antibody, TBC1 domain family member 14 L homeolog antibody, TBC1D14 antibody, tbc1d14 antibody, tbc1d14.L antibody, Tbc1d14 antibody

Background: TBC1D14 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 76 kDa (MW of target protein)