PSMA4 antibody
-
- Target See all PSMA4 Antibodies
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
- Top Product
- Discover our top product PSMA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMA4 Blocking Peptide, catalog no. 33R-6994, is also available for use as a blocking control in assays to test for specificity of this PSMA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
- Alternative Name
- PSMA4 (PSMA4 Products)
- Synonyms
- wu:fe05d10 antibody, zgc:56176 antibody, DDBDRAFT_0204055 antibody, DDBDRAFT_0214953 antibody, DDB_0204055 antibody, DDB_0214953 antibody, C9 antibody, HC9 antibody, HsT17706 antibody, PSC9 antibody, proteasome subunit alpha 4 antibody, proteasome subunit alpha 4 S homeolog antibody, proteasome subunit alpha type 4 antibody, 20S proteasome subunit alpha-4 antibody, proteasome (prosome, macropain) subunit, alpha type 4 antibody, psma4 antibody, psma4.S antibody, PSMA4 antibody, CNF01860 antibody, psmA4 antibody, Psma4 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-