HMGCLL1 antibody (N-Term)

Catalog No. ABIN632887

Product Details anti-HMGCLL1 Antibody

Target: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGCLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HMGCLL1 antibody was raised against the N terminal of HMGCLL1

Purification: Affinity purified

Immunogen: HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMGCLL1 Blocking Peptide, catalog no. 33R-6052, is also available for use as a blocking control in assays to test for specificity of this HMGCLL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMGCLL1

Target: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Alternative Name: HMGCLL1 (HMGCLL1 Products)

Synonyms: bA418P12.1 antibody, er-cHL antibody, RGD1565090 antibody, zgc:172206 antibody, BC037381 antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase like 1 antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1 antibody, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1 antibody, HMGCLL1 antibody, Hmgcll1 antibody, hmgcll1 antibody

Background: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Molecular Weight: 36 kDa (MW of target protein)