RALGDS antibody (N-Term)

Catalog No. ABIN632886

Product Details anti-RALGDS Antibody

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALGDS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RALGDS antibody was raised against the N terminal of RALGDS

Purification: Affinity purified

Immunogen: RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALGDS Blocking Peptide, catalog no. 33R-4641, is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALGDS

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Alternative Name: RALGDS (RALGDS Products)

Synonyms: RGDS antibody, RGF antibody, RalGEF antibody, Gnds antibody, Rgds antibody, mKIAA1308 antibody, RALGDS antibody, ral guanine nucleotide dissociation stimulator antibody, RALGDS antibody, Ralgds antibody, ralgds antibody

Background: The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway