PBLD1 antibody (N-Term)
-
- Target See all PBLD1 Antibodies
- PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PBLD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PBLD antibody was raised against the N terminal of PBLD
- Purification
- Affinity purified
- Immunogen
- PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR
- Top Product
- Discover our top product PBLD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PBLD Blocking Peptide, catalog no. 33R-4526, is also available for use as a blocking control in assays to test for specificity of this PBLD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBLD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))
- Alternative Name
- PBLD (PBLD1 Products)
- Synonyms
- MAWBP antibody, MAWDBP antibody, 0610038K03Rik antibody, Mawbp antibody, Pbld antibody, phenazine biosynthesis like protein domain containing antibody, phenazine biosynthesis-like protein domain containing 1 antibody, PBLD antibody, Pbld1 antibody
- Background
- The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 31 kDa (MW of target protein)
-