C3orf62 antibody (Middle Region)

Catalog No. ABIN632849

Product Details anti-C3orf62 Antibody

Target: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C3orf62 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C3 ORF62 antibody was raised against the middle region of C3 rf62

Purification: Affinity purified

Immunogen: C3 ORF62 antibody was raised using the middle region of C3 rf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C3orf62

Target: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Alternative Name: C3ORF62 (C3orf62 Products)

Synonyms: chromosome 3 open reading frame 62 antibody, C3orf62 antibody

Background: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)