HDDC3 antibody (Middle Region)
-
- Target See all HDDC3 Antibodies
- HDDC3 (HD Domain Containing 3 (HDDC3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HDDC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HDDC3 antibody was raised against the middle region of HDDC3
- Purification
- Affinity purified
- Immunogen
- HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI
- Top Product
- Discover our top product HDDC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDDC3 (HD Domain Containing 3 (HDDC3))
- Alternative Name
- HDDC3 (HDDC3 Products)
- Synonyms
- MESH1 antibody, zgc:110184 antibody, 1110033O09Rik antibody, C86475 antibody, RGD1311839 antibody, HD domain containing 3 antibody, HD domain containing 3 S homeolog antibody, hddc3 antibody, HDDC3 antibody, hddc3.S antibody, Hddc3 antibody
- Background
- The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 16 kDa (MW of target protein)
-