WDR53 antibody (Middle Region)

Catalog No. ABIN632845

Product Details anti-WDR53 Antibody

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR53 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR53 antibody was raised against the middle region of WDR53

Purification: Affinity purified

Immunogen: WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR53 Blocking Peptide, catalog no. 33R-6765, is also available for use as a blocking control in assays to test for specificity of this WDR53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR53

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Alternative Name: WDR53 (WDR53 Products)

Synonyms: 1500002B03Rik antibody, AI848860 antibody, RGD1559546 antibody, WD repeat domain 53 antibody, WDR53 antibody, Wdr53 antibody

Background: The function of WDR53 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)