LYPD5 antibody (N-Term)

Catalog No. ABIN632843

Product Details anti-LYPD5 Antibody

Target: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPD5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYPD5 antibody was raised against the N terminal of LYPD5

Purification: Affinity purified

Immunogen: LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPD5 Blocking Peptide, catalog no. 33R-10024, is also available for use as a blocking control in assays to test for specificity of this LYPD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPD5

Target: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Alternative Name: LYPD5 (LYPD5 Products)

Synonyms: RGD1560355 antibody, PRO4356 antibody, 2210003I03Rik antibody, Ly6/Plaur domain containing 5 antibody, LY6/PLAUR domain containing 5 antibody, Lypd5 antibody, LYPD5 antibody

Background: The function of LYPD5 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 22 kDa (MW of target protein)