C1ORF110 antibody (Middle Region)

Catalog No. ABIN632841

Product Details anti-C1ORF110 Antibody

Target: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1ORF110 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF110 antibody was raised against the middle region of C1 rf110

Purification: Affinity purified

Immunogen: C1 ORF110 antibody was raised using the middle region of C1 rf110 corresponding to a region with amino acids SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF110 Blocking Peptide, catalog no. 33R-8546, is also available for use as a blocking control in assays to test for specificity of this C1ORF110 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1ORF110

Target: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Alternative Name: C1ORF110 (C1ORF110 Products)

Synonyms: C1orf110 antibody, coiled-coil domain containing 190 antibody, CCDC190 antibody, Ccdc190 antibody

Background: The function of C1orf110 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)