C5orf36 antibody (N-Term)

Catalog No. ABIN632837

Product Details anti-C5orf36 Antibody

Target: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C5orf36 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C5 ORF36 antibody was raised against the N terminal Of C5 rf36

Purification: Affinity purified

Immunogen: C5 ORF36 antibody was raised using the N terminal Of C5 rf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C5ORF36 Blocking Peptide, catalog no. 33R-1681, is also available for use as a blocking control in assays to test for specificity of this C5ORF36 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C5orf36

Target: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Alternative Name: C5ORF36 (C5orf36 Products)

Synonyms: C5orf36 antibody, KIAA0825 antibody, KIAA0825 antibody

Background: The specific function of C5orf36 is not yet known.

Molecular Weight: 37 kDa (MW of target protein)