FAM98B antibody (N-Term)

Catalog No. ABIN632834

Product Details anti-FAM98B Antibody

Target: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM98B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM98 B antibody was raised against the N terminal of FAM98

Purification: Affinity purified

Immunogen: FAM98 B antibody was raised using the N terminal of FAM98 corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM98B Blocking Peptide, catalog no. 33R-5475, is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM98B

Target: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Alternative Name: FAM98B (FAM98B Products)

Synonyms: 2610510H03Rik antibody, RGD1564603 antibody, family with sequence similarity 98 member B antibody, family with sequence similarity 98, member B antibody, FAM98B antibody, Fam98b antibody

Background: The specific function of FAM98B is not yet known.

Molecular Weight: 45 kDa (MW of target protein)