PXT1 antibody (Middle Region)
-
- Target See all PXT1 products
- PXT1 (Peroxisomal, Testis Specific 1 (PXT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PXT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PXT1 antibody was raised against the middle region of PXT1
- Purification
- Affinity purified
- Immunogen
- PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PXT1 Blocking Peptide, catalog no. 33R-6334, is also available for use as a blocking control in assays to test for specificity of this PXT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PXT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PXT1 (Peroxisomal, Testis Specific 1 (PXT1))
- Alternative Name
- PXT1 (PXT1 Products)
- Synonyms
- STEPP antibody, 1700001G18Rik antibody, Stepp antibody, peroxisomal, testis specific 1 antibody, PXT1 antibody, Pxt1 antibody
- Background
- The function of PXT1 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 6 kDa (MW of target protein)
-