C4orf22 antibody (N-Term)
-
- Target See all C4orf22 products
- C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C4orf22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C4 ORF22 antibody was raised against the N terminal Of C4 rf22
- Purification
- Affinity purified
- Immunogen
- C4 ORF22 antibody was raised using the N terminal Of C4 rf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C4ORF22 Blocking Peptide, catalog no. 33R-10163, is also available for use as a blocking control in assays to test for specificity of this C4ORF22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))
- Alternative Name
- C4ORF22 (C4orf22 Products)
- Background
- The specific function of C4orf22 is not yet known.
- Molecular Weight
- 27 kDa (MW of target protein)
-