AKD1 antibody (N-Term)

Catalog No. ABIN632823

Product Details anti-AKD1 Antibody

Target: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C6 ORF199 antibody was raised against the N terminal Of C6 rf199

Purification: Affinity purified

Immunogen: C6 ORF199 antibody was raised using the N terminal Of C6 rf199 corresponding to a region with amino acids TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF199 Blocking Peptide, catalog no. 33R-9292, is also available for use as a blocking control in assays to test for specificity of this C6ORF199 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF199 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKD1

Target: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Alternative Name: C6ORF199 (ADK1 Products)

Background: The function of the C6orf199 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 48 kDa (MW of target protein)