ZCCHC14 antibody (N-Term)

Catalog No. ABIN632807

Product Details anti-ZCCHC14 Antibody

Target: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCCHC14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZCCHC14 antibody was raised against the N terminal of ZCCHC14

Purification: Affinity purified

Immunogen: ZCCHC14 antibody was raised using the N terminal of ZCCHC14 corresponding to a region with amino acids RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZCCHC14 Blocking Peptide, catalog no. 33R-8278, is also available for use as a blocking control in assays to test for specificity of this ZCCHC14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCCHC14

Target: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Alternative Name: ZCCHC14 (ZCCHC14 Products)

Synonyms: MGC131346 antibody, BDG-29 antibody, BDG29 antibody, AA792890 antibody, RGD1309494 antibody, zinc finger CCHC-type containing 14 antibody, zinc finger CCHC-type containing 14 L homeolog antibody, zinc finger CCHC domain-containing protein 14 antibody, zinc finger, CCHC domain containing 14 antibody, ZCCHC14 antibody, zcchc14.L antibody, LOC100082786 antibody, zcchc14 antibody, LOC100539002 antibody, Zcchc14 antibody

Background: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Molecular Weight: 100 kDa (MW of target protein)