R3HDM2 antibody (Middle Region)

Catalog No. ABIN632805

Product Details anti-R3HDM2 Antibody

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This R3HDM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: R3 HDM2 antibody was raised against the middle region of R3 DM2

Purification: Affinity purified

Immunogen: R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

R3HDM2 Blocking Peptide, catalog no. 33R-7740, is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for R3HDM2

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Alternative Name: R3HDM2 (R3HDM2 Products)

Synonyms: PR01365 antibody, 1300003K24Rik antibody, AU041262 antibody, mKIAA1002 antibody, RGD1310066 antibody, R3H domain containing 2 antibody, R3HDM2 antibody, R3hdm2 antibody

Background: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Molecular Weight: 68 kDa (MW of target protein)