PHLDA3 antibody (N-Term)

Catalog No. ABIN632801

Product Details anti-PHLDA3 Antibody

Target: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHLDA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PHLDA3 antibody was raised against the N terminal of PHLDA3

Purification: Affinity purified

Immunogen: PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHLDA3 Blocking Peptide, catalog no. 33R-5324, is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHLDA3

Target: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Alternative Name: PHLDA3 (PHLDA3 Products)

Synonyms: TIH1 antibody, Tih1 antibody, si:dz182n13.5 antibody, zgc:92333 antibody, pleckstrin homology like domain family A member 3 antibody, pleckstrin homology like domain, family A, member 3 antibody, pleckstrin homology-like domain, family A, member 3 antibody, PHLDA3 antibody, Phlda3 antibody, phlda3 antibody

Background: PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.

Molecular Weight: 14 kDa (MW of target protein)