SOHLH1 antibody (C-Term)

Catalog No. ABIN632790

Product Details anti-SOHLH1 Antibody

Target: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOHLH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SOHLH1 antibody was raised against the C terminal of SOHLH1

Purification: Affinity purified

Immunogen: SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOHLH1 Blocking Peptide, catalog no. 33R-6990, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOHLH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOHLH1

Target: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Alternative Name: SOHLH1 (SOHLH1 Products)

Synonyms: C9orf157 antibody, NOHLH antibody, SPATA27 antibody, TEB2 antibody, bA100C15.3 antibody, bHLHe80 antibody, Gm110 antibody, Nohlh antibody, RGD1564440 antibody, spermatogenesis and oogenesis specific basic helix-loop-helix 1 antibody, SOHLH1 antibody, Sohlh1 antibody

Background: SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Molecular Weight: 41 kDa (MW of target protein)