C12orf40 antibody (N-Term)

Catalog No. ABIN632785

Product Details anti-C12orf40 Antibody

Target: C12orf40 (Chromosome 12 Open Reading Frame 40 (C12orf40))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12orf40 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C12 ORF40 antibody was raised against the N terminal Of C12 rf40

Purification: Affinity purified

Immunogen: C12 ORF40 antibody was raised using the N terminal Of C12 rf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF40 Blocking Peptide, catalog no. 33R-2601, is also available for use as a blocking control in assays to test for specificity of this C12ORF40 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12orf40

Target: C12orf40 (Chromosome 12 Open Reading Frame 40 (C12orf40))

Alternative Name: C12ORF40 (C12orf40 Products)

Synonyms: chromosome 12 open reading frame 40 antibody, C12orf40 antibody

Background: The function of C12orf40 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 74 kDa (MW of target protein)