CCDC7 antibody (N-Term)
-
- Target See all CCDC7 Antibodies
- CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC7 antibody was raised against the N terminal of CCDC7
- Purification
- Affinity purified
- Immunogen
- CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI
- Top Product
- Discover our top product CCDC7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC7 Blocking Peptide, catalog no. 33R-4415, is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))
- Alternative Name
- CCDC7 (CCDC7 Products)
- Synonyms
- dJ1104A8.1 antibody, 4930517G15Rik antibody, 4930540C21Rik antibody, Biot2 antibody, CCDC7 antibody, QtsA-13472 antibody, coiled-coil domain containing 7 antibody, coiled-coil domain containing 7A antibody, uncharacterized protein C10orf68 antibody, coiled-coil domain-containing protein 7 antibody, Coiled-coil domain-containing protein 7 antibody, CCDC7 antibody, Ccdc7a antibody, Ccdc7 antibody, LOC616662 antibody, LOC103350869 antibody, LOC100060704 antibody
- Background
- The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 56 kDa (MW of target protein)
-