MAGEA4 antibody (C-Term)
-
- Target See all MAGEA4 Antibodies
- MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEA4 antibody was raised against the C terminal of MAGEA4
- Purification
- Affinity purified
- Immunogen
- MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP
- Top Product
- Discover our top product MAGEA4 Primary Antibody
-
anti-Melanoma Antigen Family A, 4 (MAGEA4) antibody
MAGEA4 Reactivity: Human WB, IHC, IHC (p), IF Host: Mouse Monoclonal 2C1 unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 9-38), (N-Term) antibodyMAGEA4 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB2196 unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 98-171) antibodyMAGEA4 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 3D12 unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 98-171) antibodyMAGEA4 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) antibodyMAGEA4 Reactivity: Human IHC, StM Host: Mouse Monoclonal CPTC-MAGEA4-1 unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 1-317) antibodyMAGEA4 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 110-210) antibodyMAGEA4 Reactivity: Human WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 1-270) antibodyMAGEA4 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (C-Term) antibodyMAGEA4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Melanoma Antigen Family A, 4 (MAGEA4) (AA 1-317) antibodyMAGEA4 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA4 Blocking Peptide, catalog no. 33R-2620, is also available for use as a blocking control in assays to test for specificity of this MAGEA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))
- Alternative Name
- MAGEA4 (MAGEA4 Products)
- Synonyms
- Mage-a4 antibody, MAGEA4 antibody, CT1.4 antibody, MAGE-41 antibody, MAGE-X2 antibody, MAGE4 antibody, MAGE4A antibody, MAGE4B antibody, melanoma antigen, family A, 4 antibody, MAGE family member A4 antibody, Magea4 antibody, MAGEA4 antibody
- Background
- MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
- Molecular Weight
- 35 kDa (MW of target protein)
-
