GOLGA7B antibody (N-Term)

Catalog No. ABIN632779

Product Details anti-GOLGA7B Antibody

Target: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOLGA7B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF132 antibody was raised against the N terminal Of C10 rf132

Purification: Affinity purified

Immunogen: C10 ORF132 antibody was raised using the N terminal Of C10 rf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF132 Blocking Peptide, catalog no. 33R-5771, is also available for use as a blocking control in assays to test for specificity of this C10ORF132 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF132 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOLGA7B

Target: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Alternative Name: C10ORF132 (GOLGA7B Products)

Synonyms: 4933417O08Rik antibody, AI839934 antibody, C10orf132 antibody, C10orf133 antibody, bA451M19.3 antibody, bA459F3.4 antibody, golgin A7 family, member B antibody, golgin A7 family, member Bb antibody, golgi autoantigen, golgin subfamily a, 7B antibody, golgin A7 family member B antibody, Golga7b antibody, golga7bb antibody, GOLGA7B antibody

Background: C10orf132 may be involved in protein transport from Golgi to cell surface (By similarity).

Molecular Weight: 18 kDa (MW of target protein)