FAM116A antibody (Middle Region)

Catalog No. ABIN632778

Product Details anti-FAM116A Antibody

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM116A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM116 A antibody was raised against the middle region of FAM116

Purification: Affinity purified

Immunogen: FAM116 A antibody was raised using the middle region of FAM116 corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM116A Blocking Peptide, catalog no. 33R-4585, is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM116A

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Alternative Name: FAM116A (FAM116A Products)

Synonyms: AFI1A antibody, FAM116A antibody, A630054L15Rik antibody, Fam116a antibody, mFLJ00229 antibody, RGD1306064 antibody, fam116a antibody, fam116aa antibody, zgc:103543 antibody, DENN domain containing 6A antibody, DENN/MADD domain containing 6A antibody, DENN/MADD domain containing 6Aa antibody, DENND6A antibody, Dennd6a antibody, dennd6aa antibody

Background: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Molecular Weight: 67 kDa (MW of target protein)