PRELID2 antibody (C-Term)

Catalog No. ABIN632775

Product Details anti-PRELID2 Antibody

Target: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRELID2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRELID2 antibody was raised against the C terminal of PRELID2

Purification: Affinity purified

Immunogen: PRELID2 antibody was raised using the C terminal of PRELID2 corresponding to a region with amino acids GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRELID2 Blocking Peptide, catalog no. 33R-3533, is also available for use as a blocking control in assays to test for specificity of this PRELID2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRELID2

Target: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Alternative Name: PRELID2 (PRELID2 Products)

Synonyms: 1700003A01Rik antibody, C330008K14Rik antibody, PRELID2 antibody, PRELI domain containing 2 antibody, PRELI domain containing 2 L homeolog antibody, PRELID2 antibody, Prelid2 antibody, prelid2.L antibody

Background: PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

Molecular Weight: 22 kDa (MW of target protein)