THAP5 antibody (Middle Region)

Catalog No. ABIN632774

Product Details anti-THAP5 Antibody

Target: THAP5 (THAP Domain Containing 5 (THAP5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THAP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: THAP5 antibody was raised against the middle region of THAP5

Purification: Affinity purified

Immunogen: THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THAP5 Blocking Peptide, catalog no. 33R-9320, is also available for use as a blocking control in assays to test for specificity of this THAP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THAP5

Target: THAP5 (THAP Domain Containing 5 (THAP5))

Alternative Name: THAP5 (THAP5 Products)

Synonyms: THAP domain containing 5 antibody, THAP domain containing 5 S homeolog antibody, THAP5 antibody, thap5.S antibody

Background: THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

Molecular Weight: 44 kDa (MW of target protein)