OLFML2A antibody (N-Term)

Catalog No. ABIN632773

Product Details anti-OLFML2A Antibody

Target: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLFML2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OLFML2 A antibody was raised against the N terminal of OLFML2

Purification: Affinity purified

Immunogen: OLFML2 A antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFML2A Blocking Peptide, catalog no. 33R-2311, is also available for use as a blocking control in assays to test for specificity of this OLFML2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLFML2A

Target: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Alternative Name: OLFML2A (OLFML2A Products)

Synonyms: si:ch211-15b7.4 antibody, PRO34319 antibody, 4932431K08Rik antibody, mFLJ00237 antibody, olfactomedin-like 2A antibody, olfactomedin like 2A L homeolog antibody, olfactomedin like 2A antibody, olfml2a antibody, olfml2a.L antibody, OLFML2A antibody, Olfml2a antibody

Background: The exact function of OLFML2A is not known.

Molecular Weight: 73 kDa (MW of target protein)