DNAJC24 antibody (N-Term)

Catalog No. ABIN632772

Product Details anti-DNAJC24 Antibody

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DPH4 antibody was raised against the N terminal Of Dph4

Purification: Affinity purified

Immunogen: DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPH4 Blocking Peptide, catalog no. 33R-6225, is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC24

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Alternative Name: DPH4 (DNAJC24 Products)

Synonyms: DPH4 antibody, JJJ3 antibody, ZCSL3 antibody, 1700030A21Rik antibody, 2610027M02Rik antibody, AV066965 antibody, AW240712 antibody, Dph4 antibody, MmDjC7 antibody, Zcsl3 antibody, RGD1564710 antibody, DnaJ heat shock protein family (Hsp40) member C24 antibody, DNAJC24 antibody, Dnajc24 antibody

Background: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molecular Weight: 17 kDa (MW of target protein)