CCDC60 antibody (C-Term)
-
- Target See all CCDC60 Antibodies
- CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))
-
Binding Specificity
- C-Term
-
Reactivity
- Rat, Mouse, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC60 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC60 antibody was raised against the C terminal of CCDC60
- Purification
- Affinity purified
- Immunogen
- CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV
- Top Product
- Discover our top product CCDC60 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC60 Blocking Peptide, catalog no. 33R-8088, is also available for use as a blocking control in assays to test for specificity of this CCDC60 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC60 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))
- Alternative Name
- CCDC60 (CCDC60 Products)
- Synonyms
- AU018954 antibody, C130098D09 antibody, coiled-coil domain containing 60 antibody, transmembrane protein 233 antibody, CCDC60 antibody, TMEM233 antibody, Ccdc60 antibody
- Background
- The function of CCDC60 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 63 kDa (MW of target protein)
-