NR2C2AP antibody (N-Term)

Catalog No. ABIN632770

Product Details anti-NR2C2AP Antibody

Target: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR2C2AP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRA16 antibody was raised against the N terminal Of Tra16

Purification: Affinity purified

Immunogen: TRA16 antibody was raised using the N terminal Of Tra16 corresponding to a region with amino acids THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRA16 Blocking Peptide, catalog no. 33R-9109, is also available for use as a blocking control in assays to test for specificity of this TRA16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRA16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR2C2AP

Target: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Alternative Name: TRA16 (NR2C2AP Products)

Synonyms: tra16 antibody, NR2C2AP antibody, TRA16 antibody, 2310073E15Rik antibody, si:ch211-125m10.4 antibody, zgc:136330 antibody, nuclear receptor 2C2-associated protein antibody, nuclear receptor 2C2 associated protein antibody, nuclear receptor 2C2-associated protein S homeolog antibody, nr2c2ap antibody, NR2C2AP antibody, Nr2c2ap antibody, nr2c2ap.S antibody

Background: TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway