NR2C2AP antibody (N-Term)
-
- Target See all NR2C2AP Antibodies
- NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR2C2AP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRA16 antibody was raised against the N terminal Of Tra16
- Purification
- Affinity purified
- Immunogen
- TRA16 antibody was raised using the N terminal Of Tra16 corresponding to a region with amino acids THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL
- Top Product
- Discover our top product NR2C2AP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRA16 Blocking Peptide, catalog no. 33R-9109, is also available for use as a blocking control in assays to test for specificity of this TRA16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRA16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))
- Alternative Name
- TRA16 (NR2C2AP Products)
- Background
- TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway
-