C19orf21 antibody (C-Term)
-
- Target See all C19orf21 (MISP) products
- C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C19orf21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C19 ORF21 antibody was raised against the C terminal Of C19 rf21
- Purification
- Affinity purified
- Immunogen
- C19 ORF21 antibody was raised using the C terminal Of C19 rf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF21 Blocking Peptide, catalog no. 33R-8150, is also available for use as a blocking control in assays to test for specificity of this C19ORF21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))
- Alternative Name
- C19ORF21 (MISP Products)
- Background
- The function of C19orf21 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 75 kDa (MW of target protein)
-