C5orf35 antibody (N-Term)
-
- Target See all C5orf35 products
- C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C5orf35 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C5 ORF35 antibody was raised against the N terminal Of C5 rf35
- Purification
- Affinity purified
- Immunogen
- C5 ORF35 antibody was raised using the N terminal Of C5 rf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C5ORF35 Blocking Peptide, catalog no. 33R-7722, is also available for use as a blocking control in assays to test for specificity of this C5ORF35 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF35 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))
- Alternative Name
- C5ORF35 (C5orf35 Products)
- Synonyms
- DKFZp468C1120 antibody, C5orf35 antibody, SET domain containing 9 antibody, SETD9 antibody, setd9 antibody
- Background
- The function of C5orf35 has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 34 kDa (MW of target protein)
-