FAM71A antibody (C-Term)
-
- Target See all FAM71A products
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM71A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM71 A antibody was raised against the C terminal of FAM71
- Purification
- Affinity purified
- Immunogen
- FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
- Alternative Name
- FAM71A (FAM71A Products)
- Background
- FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.
- Molecular Weight
- 63 kDa (MW of target protein)
-