TBC1D21 antibody (N-Term)

Catalog No. ABIN632761

Product Details anti-TBC1D21 Antibody

Target: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D21 antibody was raised against the N terminal of TBC1 21

Purification: Affinity purified

Immunogen: TBC1 D21 antibody was raised using the N terminal of TBC1 21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D21 Blocking Peptide, catalog no. 33R-6568, is also available for use as a blocking control in assays to test for specificity of this TBC1D21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D21

Target: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Alternative Name: TBC1D21 (TBC1D21 Products)

Synonyms: 1700095K08Rik antibody, MgcRabGAP antibody, RGD1310243 antibody, TBC1 domain family, member 21 antibody, TBC1 domain family member 21 antibody, Tbc1d21 antibody, TBC1D21 antibody

Background: TBC1D21 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 39 kDa (MW of target protein)