IQCK antibody (Middle Region)

Catalog No. ABIN632754

Product Details anti-IQCK Antibody

Target: IQCK (IQ Motif Containing K (IQCK))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IQCK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IQCK antibody was raised against the middle region of IQCK

Purification: Affinity purified

Immunogen: IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IQCK Blocking Peptide, catalog no. 33R-3433, is also available for use as a blocking control in assays to test for specificity of this IQCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IQCK

Target: IQCK (IQ Motif Containing K (IQCK))

Alternative Name: IQCK (IQCK Products)

Synonyms: A230094G09Rik antibody, IQ motif containing K antibody, IQCK antibody, Iqck antibody

Background: The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)