C22orf25 antibody (N-Term)

Catalog No. ABIN632752

Product Details anti-C22orf25 Antibody

Target: C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C22orf25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C22 ORF25 antibody was raised against the N terminal Of C22 rf25

Purification: Affinity purified

Immunogen: C22 ORF25 antibody was raised using the N terminal Of C22 rf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C22ORF25 Blocking Peptide, catalog no. 33R-5813, is also available for use as a blocking control in assays to test for specificity of this C22ORF25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C22orf25

Target: C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))

Alternative Name: C22ORF25 (C22orf25 Products)

Synonyms: c22orf25 antibody, MGC88919 antibody, C22orf25 antibody, TANGO2 antibody, C17H22orf25 antibody, transport and golgi organization 2 homolog L homeolog antibody, transport and golgi organization 2 homolog antibody, transport and golgi organization 2 homolog (Drosophila) antibody, tango2.L antibody, tango2 antibody, TANGO2 antibody

Background: The function of C22orf25 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)