PDIK1L antibody (Middle Region)

Catalog No. ABIN632750

Product Details anti-PDIK1L Antibody

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDIK1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDIK1 L antibody was raised against the middle region of PDIK1

Purification: Affinity purified

Immunogen: PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDIK1L Blocking Peptide, catalog no. 33R-2870, is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDIK1L

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Alternative Name: PDIK1L (PDIK1L Products)

Synonyms: CLIK1L antibody, STK35L2 antibody, BC027088 antibody, stk35l2 antibody, RGD1307476 antibody, Stk35l2 antibody, pdik1-a antibody, pdik1l antibody, pdik1-b antibody, MGC81117 antibody, wu:fc95a02 antibody, zgc:123209 antibody, LOC100224737 antibody, PDLIM1 interacting kinase 1 like antibody, PDLIM1 interacting kinase 1 like S homeolog antibody, PDLIM1 interacting kinase 1 like L homeolog antibody, PDIK1L antibody, Pdik1l antibody, pdik1l.S antibody, pdik1l.L antibody, pdik1l antibody

Background: The specific function of PDIK1L is not yet known.

Molecular Weight: 38 kDa (MW of target protein)