NANP antibody (Middle Region)

Catalog No. ABIN632748

Product Details anti-NANP Antibody

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NANP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NANP antibody was raised against the middle region of NANP

Purification: Affinity purified

Immunogen: NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NANP Blocking Peptide, catalog no. 33R-9755, is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Preservative: Sodium azide

Precaution of Use: This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NANP

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Alternative Name: NANP (NANP Products)

Synonyms: rgd1306009 antibody, C20orf147 antibody, HDHD4 antibody, dJ694B14.3 antibody, 1600031M04Rik antibody, Hdhd4 antibody, RGD1306009 antibody, zgc:111947 antibody, N-acylneuraminate-9-phosphatase antibody, N-acetylneuraminic acid phosphatase antibody, N-acetylneuraminic acid phosphatase L homeolog antibody, nanp antibody, NANP antibody, Nanp antibody, nanp.L antibody

Background: The function of NANP protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 28 kDa (MW of target protein)